DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx18 and ufe1

DIOPT Version :9

Sequence 1:NP_524485.1 Gene:Syx18 / 42933 FlyBaseID:FBgn0039212 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_588045.1 Gene:ufe1 / 2538886 PomBaseID:SPCC895.04c Length:319 Species:Schizosaccharomyces pombe


Alignment Length:406 Identity:76/406 - (18%)
Similarity:135/406 - (33%) Gaps:142/406 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKAKPATVPTKTGPIGPKDDFAKQAKEVCNKITSLRNVLIENRTAYM---------RIGQHLK-- 77
            |....|.:|.|.  |...|.|..:...:...|.:|...|.:.|.||:         |:.:.|.  
pombe    15 GDIDAANIPLKR--ISYTDPFLAEGYRIHETIVNLLVFLKKIRGAYLKDRTFSNVQRLSKPLMEC 77

  Fly    78 -----SAAHMTDAQRDLIDRESEKFVTFYTQHLAKM-------------RSDWKSAKRKPQERQ- 123
                 |...:.:.|||.|:.|....::.....:||:             :|.|....|.|.:.. 
pombe    78 SLEELSKLELDEVQRDEIEHEVSSAISSCIHQIAKLQEIVKEQQSQIPKKSGWLQGLRDPSKLSK 142

  Fly   124 ------HIDAVLDLLVSYLHSVEQIYLDQKKYRVQHELETYRLLKLAADKKKIPVRPAGSNSGKL 182
                  |..:||..|.|.|..|..:.     |.:|.       |:|...::|             
pombe   143 KETLVAHHSSVLWYLQSELSDVSSVL-----YHLQD-------LRLKRGQEK------------- 182

  Fly   183 GRRQVSNDDSEATKSSSQANGNHDESADNDWNNDAWGDWDEDEEGDEVDDHDGEKGKEANQANQH 247
              |.:::|  ..||:.:..|                       ...|:.:               
pombe   183 --RNIASD--FLTKNPTDEN-----------------------SAVEIPE--------------- 205

  Fly   248 KPRTRKRSKANRSDLNNSSSKMALDEELQQQQEADDDDPLSAEDVQLFEAENVHIYNFLQGVSEE 312
                        |:|....::..| :||:|:           .||.|.|.|:         ..|.
pombe   206 ------------SELQTFFTQQQL-QELEQE-----------NDVLLQEFEH---------TMER 237

  Fly   313 VEQIEKNVVDIAQLQDIFTEKVAMQQHNIDRIVSAVVGTTENVKDANEQIRQATQRNAGLRVWSL 377
            :....|::.||.:||...:.::::|....:::....:...:::...|:|:.:|..|::  |...|
pombe   238 LRDTGKSLADITRLQSEISAQLSIQSSAAEKLYDDALNVMDSLSGGNQQLIKAKSRSS--RTARL 300

  Fly   378 FFLL--VMSFSLLFLD 391
            .|.:  ||...||.||
pombe   301 LFCIFTVMGLLLLSLD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx18NP_524485.1 Syntaxin-18_N 2..90 CDD:287468 19/81 (23%)
SNARE_syntaxin18 306..364 CDD:277203 9/57 (16%)
ufe1NP_588045.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3894
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004915
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103713
Panther 1 1.100 - - LDO PTHR15959
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.