DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13625 and cwf26

DIOPT Version :9

Sequence 1:NP_651272.1 Gene:CG13625 / 42931 FlyBaseID:FBgn0039210 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_588468.2 Gene:cwf26 / 2538931 PomBaseID:SPCC1620.10 Length:306 Species:Schizosaccharomyces pombe


Alignment Length:213 Identity:70/213 - (32%)
Similarity:114/213 - (53%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 GLQDAKSLKKETDERRRQEHELFEKMSSEISGRDGDVQVRSTRRKGHR-----------ARDAAN 501
            ||...|.:..:.:|||::|.:     ||.:.    :.::|.:|...:|           ||..|.
pombe   120 GLLTGKQVTFKAEERRKREEK-----SSNLD----EEELRKSRETVYRDATGRRIDLVLARKEAK 175

  Fly   502 EDPAEQGRKEEHEKKKKELYDRWGKGLKQIEDHKSRLEEMVHEASKPVARYANDEDLDRHLREQE 566
            ....|   |||..:::||..    :|:.|:...|..|:|:..:.:.|:|||.:|.:.::.|:|:.
pombe   176 RKLKE---KEEEARRQKEQQ----QGVVQVRQQKEYLKELERQKTVPLARYEDDPEYNKELKERS 233

  Fly   567 HADDPMLEYMRQKRKKRDQQDNKPVMPK--YEGSFPENRFGIRPGYRWDGVDRSNGYEQRWFDKQ 629
            ..:||...::          .||||..|  |:|..|.|||.||||:||||:.|.||:|.:||.:|
pombe   234 RWNDPAASFL----------TNKPVSSKATYQGYAPPNRFNIRPGHRWDGIIRGNGFENKWFQRQ 288

  Fly   630 NERRAVQDEAYKYSVEDM 647
            |||:|.:.||:.:::|||
pombe   289 NERKAQEHEAHMWAIEDM 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13625NP_651272.1 Bud13 490..630 CDD:286779 50/152 (33%)
cwf26NP_588468.2 Bud13 154..289 CDD:286779 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I1966
eggNOG 1 0.900 - - E1_KOG2654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005007
OrthoInspector 1 1.000 - - oto100871
orthoMCL 1 0.900 - - OOG6_103002
Panther 1 1.100 - - LDO PTHR31809
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R271
SonicParanoid 1 1.000 - - X3540
TreeFam 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.