DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K9 and BCK1

DIOPT Version :9

Sequence 1:XP_011535090.1 Gene:MAP3K9 / 4293 HGNCID:6861 Length:1166 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:87/334 - (26%)
Similarity:150/334 - (44%) Gaps:57/334 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   148 EIIGIGGFGKVYRAFWI--GDEVAVKAAR----HDPDEDISQTIENVRQEAKLFAMLKHPNIIAL 206
            |:||.|.||.||....:  |:.:|||...    ...:|.|..|:|.:|.|......|.|.||:..
Yeast  1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQY 1243

Human   207 RGVCLKEPNLCLVMEFARGGPLNRVLS--GKRIPPDILVNWAVQIARGMNYLHDEAIVPIIHRDL 269
            .|...|.....|.:|:..||.:..::.  | |....::.:...|:.:|:.|||.:.   |:|||:
Yeast  1244 LGFENKNNIYSLFLEYVAGGSVGSLIRMYG-RFDEPLIKHLTTQVLKGLAYLHSKG---ILHRDM 1304

Human   270 KSSNILILQKVENGDLSNKILKITDFGLAR---EWHRTTKMSAAGTYAWMAPEVIRASM-FSKGS 330
            |:.|:|:.|        :.|.||:|||::|   :.:..:.|:..||..|||||::.... :|...
Yeast  1305 KADNLLLDQ--------DGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKV 1361

Human   331 DVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIP-STCP---EPFAKLMEDCWNPDPH 391
            |:||.|.::.|:..|:.|:..::.:|..:.:..:|.|.||| .|.|   :.....::.|:..:|.
Yeast  1362 DIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPE 1426

Human   392 SRPSFTNILDQLTTIEESGFFEMPKDSFHCLQDNWKHEIQEMFDQLRAKEKELRTW---EEELTR 453
            .||:...:|                          .|...|:.:....|...|..:   .::|..
Yeast  1427 KRPTANELL--------------------------SHPFSEVNETFNFKSTRLAKFIKSNDKLNS 1465

Human   454 AALQQKNQE 462
            :.|:..:||
Yeast  1466 SKLRITSQE 1474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K9XP_011535090.1 SH3_MLK1-3 56..113 CDD:212992
STKc_MLK1 137..406 CDD:271047 79/273 (29%)
TyrKc 144..403 CDD:197581 79/270 (29%)
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 80/298 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.