DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and INN1

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_014247.1 Gene:INN1 / 855570 SGDID:S000005096 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:55/307 - (17%)
Similarity:109/307 - (35%) Gaps:80/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SSAVLSVFIDSARHLKQARSSSKPDPYLVCSVNKQKQQTAMIMR-DDSPVWEQGFTFLVSNPDNE 560
            :..:|||::..||.|.......|.:..|...:....:.:..:.| ..:||:.....|.::.....
Yeast     9 NQGILSVYVSKARDLPNLNKLDKQNVMLRLRIAHMTRASNTLHRAGQNPVFHYLEKFDITPEIKP 73

  Fly   561 SLNIKIY---DQKTGNDIGQYTYTLSTLLKQFNMEVIQQPFQLQKSGPE--SKLYMSLSLRILKP 620
            .:.:::|   .:|:...||:....|...::....|.....::|::||.|  ..:::.|:.....|
Yeast    74 LMYVEVYCDRRKKSPLPIGRCEIDLLNAIRADPKEGYCTWYELKRSGDEFAGTIFIELTFTPKVP 138

  Fly   621 ----GEIDKDSDALEQVAAL--------------TRSSSVK--TPDVAAVSPP------------ 653
                .:::|:.|.|:...|:              ...|:::  ||...:.|..            
Yeast   139 RLNRDDLNKEMDRLDSSMAMRPIPPLPTESEYDYVHGSTMRQITPQCVSTSHEDKDEGQPYRNGN 203

  Fly   654 AFKESQASSKRLSAESPISEEDPVAATKISPAMSAS----------------TSSEK----PISE 698
            .|..|..|...:.|.|    .||:.   :.|..|||                ||:.|    .:.:
Yeast   204 VFSMSSKSDTAVLANS----NDPII---LPPTFSASMGTTSTLETNDTAISNTSNTKFHFANLRK 261

  Fly   699 LATSVLTHRFPDSTSSPGEHGLGRMQLSIRYSAQRQKLDVTIHKIQK 745
            |...:...:.|||:::               :.|.:...|.|..:||
Yeast   262 LKEKINIFKNPDSSTN---------------NCQNESNKVDIEALQK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990
C2B_Synaptotagmin-like 500..605 CDD:176015 20/108 (19%)
C2C_KIAA1228 719..847 CDD:175996 5/27 (19%)
INN1NP_014247.1 C2_fungal_Inn1p-like 11..133 CDD:176063 23/121 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2311
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.