DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and si:ch211-240l19.7

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001076398.1 Gene:si:ch211-240l19.7 / 799219 ZFINID:ZDB-GENE-041210-329 Length:134 Species:Danio rerio


Alignment Length:75 Identity:25/75 - (33%)
Similarity:33/75 - (44%) Gaps:10/75 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 KSDPYAIINVGAQEFKTQIIDNNVNPKWD--YWCEACIFTTIGHYIGFSLWDYDQTMPGVQSDDV 434
            |.|||..|..|:....|....||.||.||  |:...|:..   :.|...:||.|     .:.||.
Zfish    46 KPDPYVKIWCGSSSVVTGYFKNNANPSWDAEYYLSGCVSR---NTIRLEVWDKD-----AKYDDR 102

  Fly   435 LGRASIDIAS 444
            :|..|..:||
Zfish   103 IGSYSGTVAS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990 25/75 (33%)
C2B_Synaptotagmin-like 500..605 CDD:176015
C2C_KIAA1228 719..847 CDD:175996
si:ch211-240l19.7NP_001076398.1 C2 33..>105 CDD:175973 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.