powered by:
Protein Alignment Esyt2 and si:ch211-240l19.7
DIOPT Version :9
Sequence 1: | NP_001247287.1 |
Gene: | Esyt2 / 42929 |
FlyBaseID: | FBgn0266758 |
Length: | 853 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076398.1 |
Gene: | si:ch211-240l19.7 / 799219 |
ZFINID: | ZDB-GENE-041210-329 |
Length: | 134 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 25/75 - (33%) |
Similarity: | 33/75 - (44%) |
Gaps: | 10/75 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 372 KSDPYAIINVGAQEFKTQIIDNNVNPKWD--YWCEACIFTTIGHYIGFSLWDYDQTMPGVQSDDV 434
|.|||..|..|:....|....||.||.|| |:...|:.. :.|...:||.| .:.||.
Zfish 46 KPDPYVKIWCGSSSVVTGYFKNNANPSWDAEYYLSGCVSR---NTIRLEVWDKD-----AKYDDR 102
Fly 435 LGRASIDIAS 444
:|..|..:||
Zfish 103 IGSYSGTVAS 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.