DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and PLA2G4A

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_005245324.2 Gene:PLA2G4A / 5321 HGNCID:9035 Length:754 Species:Homo sapiens


Alignment Length:86 Identity:24/86 - (27%)
Similarity:50/86 - (58%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 MQLSIRYSAQRQKLDVTIHKIQKIPLRDPSNIPDPYVKLYLLPGRTKESKRKTSVIKDNCNPVYD 787
            :.||:|.:..   |.:.:.|:.|....|..:.|||||:|::  ..|.:|:::|....::.|||::
Human    18 LMLSVRLAFY---LGLKLAKVTKGAFGDMLDTPDPYVELFI--STTPDSRKRTRHFNNDINPVWN 77

  Fly   788 ASFEYLISIAELRQTELEVTV 808
            .:||:::.  ..::..||:|:
Human    78 ETFEFILD--PNQENVLEITL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990
C2B_Synaptotagmin-like 500..605 CDD:176015
C2C_KIAA1228 719..847 CDD:175996 24/86 (28%)
PLA2G4AXP_005245324.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5038
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.