DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and Pla2g4a

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_598235.2 Gene:Pla2g4a / 24653 RGDID:67366 Length:752 Species:Rattus norvegicus


Alignment Length:412 Identity:89/412 - (21%)
Similarity:149/412 - (36%) Gaps:105/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 DPNDLQQILLETQ--------LLRVTSMSSAVLSVFIDSARHLKQARSSSKPDPYL---VCSVNK 530
            ||  .|.|::|.|        :||.|.::.......:|:            ||||:   :.:...
  Rat     5 DP--YQHIIVEHQYSHKFTVVVLRATKVTKGTFGDMLDT------------PDPYVELFISTTPD 55

  Fly   531 QKQQTAMIMRDDSPVWEQGFTFLVSNPDNES-LNIKIYDQKTGND--IGQYTYTLSTLLKQFNME 592
            .:::|.....|.:|||.:.|.|:: :|:.|: |.|.:.|.....|  :|..|:.:|::......|
  Rat    56 SRKRTRHFNNDINPVWNETFEFIL-DPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKE 119

  Fly   593 VIQQPFQLQKSGPESKLYMSLSLRILKPGEIDKDSDAL---EQVAALTRSSSVKTPDVAAVSPPA 654
            |   ||...:   .:::.:.:||.:....:: :.|.||   |:.....|..::|......:.|  
  Rat   120 V---PFIFNQ---VTEMILEMSLEVCSCPDL-RFSMALCDQEKTFRQQRKENIKENMKKLLGP-- 175

  Fly   655 FKESQASSKRLSAESPISEED-PVAA-----------TKISPAMSASTSSEKPISELATSVLTHR 707
             |:|         |...|..| ||.|           ...|..|.|  ..|..|.:.||.|.   
  Rat   176 -KKS---------EGLYSTRDVPVVAILGSGGGFRAMVGFSGVMKA--LYESGILDCATYVA--- 225

  Fly   708 FPDSTSSPGEHGLGRMQLSIRYSAQRQKLDVTIHKIQKIPLRDPSNIPDPYVK-------LYLLP 765
                       ||..   |..|.:       |::.....|.:.|..|.:..:|       |.|.|
  Rat   226 -----------GLSG---STWYMS-------TLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTP 269

  Fly   766 GRTKESKRKTSVIKDNCNPV-YDASFEYLISIAELRQTELEVTVCTQKGFLSGGS---PIIGMLK 826
            .:.|.........|.:..|| :...|..||. ..|.|..:..|:.:.|..:|...   |:...|.
  Rat   270 QKVKRYVESLWKKKSSGQPVTFTDIFGMLIG-ETLIQNRMSTTLSSLKEKVSAARCPLPLFTCLH 333

  Fly   827 IPLDDAEITTQTGLNSWFDLQP 848
            :..|.:|:.    ...|.:..|
  Rat   334 VKPDVSELM----FADWVEFSP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990
C2B_Synaptotagmin-like 500..605 CDD:176015 25/110 (23%)
C2C_KIAA1228 719..847 CDD:175996 29/138 (21%)
Pla2g4aNP_598235.2 Phospholipid binding. /evidence=ECO:0000305 1..178 44/197 (22%)
C2_cPLA2 20..138 CDD:176001 30/136 (22%)
cPLA2_Grp-IVA 144..730 CDD:132839 53/252 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5038
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.