DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and LOC100493855

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:XP_031756339.1 Gene:LOC100493855 / 100493855 -ID:- Length:227 Species:Xenopus tropicalis


Alignment Length:223 Identity:67/223 - (30%)
Similarity:113/223 - (50%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 WLTLEDAKHGLLHVRLQWYKLTADPNDLQQILLE---TQLLRVTSMSSAVLSVFIDSARHLKQAR 515
            |:.||:|:.|.||::|:..:|.:||..|:::|.|   ||..|.|.||||||..||:.||.|...:
 Frog    11 WIQLENAESGQLHIKLERLQLLSDPTKLEEVLKENEQTQTERRTQMSSAVLYTFIEKARGLPVVQ 75

  Fly   516 -SSSKPDPYLVCSVNKQK--QQTAMIMRDDSPVWEQGFTFLVSNPDNESLNIKIYDQKTGNDIGQ 577
             ...|.:|..|..|..|.  |:|...:::....|::.|.||:.||..|.|.:.::|::. ..:|.
 Frog    76 VQKGKLNPLAVVKVAIQDSVQETGSKVKNGEVEWKRRFQFLLRNPLTEELKLMLHDERQ-KPLGC 139

  Fly   578 YTYTLSTLLKQFNMEVIQQPFQLQKSGPESKLYMSLSLRILKPG--EIDKDSDALEQVAALTRSS 640
            ....||.|:...:| .|:....|:.:.....:.:.|.||||.|.  .:.:::...|::   ||..
 Frog   140 VAVPLSQLVDAADM-TIEDWLPLESTEENRDIRVKLQLRILAPHPYSVKEENQIPEEI---TRVP 200

  Fly   641 SVKTPDVAAVSPPAFKESQASSKRLSAE 668
            .......|.:|.   ::|.|..::|.|:
 Frog   201 LFHGETKAQISK---RKSWAKVRKLFAK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990 8/16 (50%)
C2B_Synaptotagmin-like 500..605 CDD:176015 30/107 (28%)
C2C_KIAA1228 719..847 CDD:175996
LOC100493855XP_031756339.1 C2 60..165 CDD:417471 30/106 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D196935at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.