DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Esyt2 and syt7b

DIOPT Version :9

Sequence 1:NP_001247287.1 Gene:Esyt2 / 42929 FlyBaseID:FBgn0266758 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001232886.1 Gene:syt7b / 100334336 ZFINID:ZDB-GENE-090601-6 Length:488 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:112/267 - (41%) Gaps:52/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 PFQLQKSGPESKLYMSLSLRILKPGEIDKDSDA----LEQVAALTRSSSVKTPDVAAVSPPAFKE 657
            |:...:..|:....:.|||.|   |..::|..|    |::..|.|.            :||..|.
Zfish   115 PYGDPRLTPKEGKMVVLSLAI---GLAEQDDFANLPDLQEAPADTE------------TPPTDKR 164

  Fly   658 SQASSKRLSAESPISEEDPVAATKISPAMSASTSSEKPISELATSVLTHRFPDSTSSPG----EH 718
            |.........::|....             ..|.:...:|:||.||.:...   ..|||    ||
Zfish   165 SNKPGSSPKGQTPDESH-------------RRTDANSSVSDLANSVTSDML---MLSPGSEEEEH 213

  Fly   719 ------GLGRMQLSIRYSAQRQKLDVTIHKIQKIPLRDPSNIPDPYVKLYLLPGRTKESKRKTSV 777
                  .|||:|.|:.||.|...|.|.|.|.|.:|.:|.|...||:|||||||  .|:.|.:|.|
Zfish   214 EGPVCEKLGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKLYLLP--DKKHKLETKV 276

  Fly   778 IKDNCNPVYDASFEYL-ISIAELRQTELEVTVCTQKGFLSGGSPIIGMLKIPLDDAEITTQTGLN 841
            .:.|.||.::.:|.:. ....::.|..|.:.|.....| |...| ||.:.|||:..|:.....| 
Zfish   277 KRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRF-SRNDP-IGEVSIPLNKVELVPMQTL- 338

  Fly   842 SWFDLQP 848
             |.:|:|
Zfish   339 -WKELKP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Esyt2NP_001247287.1 SMP_LBD 154..332 CDD:293652
C2A_Synaptotagmin-like 348..471 CDD:175990
C2B_Synaptotagmin-like 500..605 CDD:176015 1/7 (14%)
C2C_KIAA1228 719..847 CDD:175996 47/128 (37%)
syt7bNP_001232886.1 C2A_Synaptotagmin-7 220..344 CDD:176032 48/129 (37%)
C2B_Synaptotagmin-7 352..487 CDD:176050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.