DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5789 and YKR104W

DIOPT Version :9

Sequence 1:NP_001247286.1 Gene:CG5789 / 42928 FlyBaseID:FBgn0039207 Length:1402 Species:Drosophila melanogaster
Sequence 2:NP_013030.1 Gene:YKR104W / 853979 SGDID:S000001812 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:134/308 - (43%)
Similarity:186/308 - (60%) Gaps:28/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1104 MTSVERVLQYTELEQEPALGEKTPPQQWPTRGQVEFRNMSCRYDPNGSPVLRNLNLTIEAGWKVG 1168
            |:||||:.:||::..| :.|..:||..||..|.||.:|:|.||.|:.|..|.|::..::||.|||
Yeast     1 MSSVERIKEYTDIPSE-SNGYISPPANWPQTGDVELKNLSLRYSPHSSKALDNVSFKVKAGTKVG 64

  Fly  1169 IVGRTGAGKSSLIGALFRLAHIE-GEIFIDGIETGTISLEILRTRISIIPQDPVLFSATIRYNLD 1232
            |||||||||||:|.|::||:..| |.|.||..:...|.||.||..||.|||||.||..|:|.|||
Yeast    65 IVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLD 129

  Fly  1233 PFERYTDAELWSALEDV-----------------------ELRKAIPGLDYMVTERGGNFSVGQR 1274
            ||:||:|.:::..|..|                       :||.....|:.:|...|.|.|.|||
Yeast   130 PFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQR 194

  Fly  1275 QLLCLARAILRNNKVLVLDEATANVDPQTDALIQRTIRIKFKQCTVLTVAHRLHTVMDSDRIIVM 1339
            |||||||::|....::::|||||::|..:||.||:|||...|..|:||:||||.:|:|.|:|:||
Yeast   195 QLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYDKILVM 259

  Fly  1340 DAGVAVEFDVPYLLLKKSQGHLRQMVEATGGESEALKKTA--SDSHKR 1385
            :.|...|:|.||.|:........::...: ||.|.|.:.|  |..:||
Yeast   260 EMGRVKEYDHPYTLISDRNTIFYRLCRQS-GEFENLFELAKVSFDNKR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5789NP_001247286.1 CFTR_protein 9..1367 CDD:273530 126/286 (44%)
ABC_membrane 214..441 CDD:294371
ABCC_MRP_domain1 495..699 CDD:213217
ABC_membrane 863..1088 CDD:294371
ABCC_MRP_domain2 1135..1350 CDD:213211 110/238 (46%)
YKR104WNP_013030.1 ABCC_NFT1 27..270 CDD:213269 112/242 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0054
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.