DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13623 and isca1

DIOPT Version :10

Sequence 1:NP_651267.1 Gene:CG13623 / 42926 FlyBaseID:FBgn0039205 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001020349.1 Gene:isca1 / 573999 ZFINID:ZDB-GENE-050626-94 Length:129 Species:Danio rerio


Alignment Length:136 Identity:32/136 - (23%)
Similarity:59/136 - (43%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFLLRQVARSGLQRNLILMRHATASTSANPELSVQVSESCLKRLREICVDGSFLRVTVEGGGCSG 66
            |.:.|...|:..:|.::..|.|...|.:        :.:.:|:|.:...:...|:|.|...||:|
Zfish     3 ASIARATVRAVSRRKILSTRAALTLTPS--------AVNKVKQLLDNKPEYIGLKVGVRTRGCNG 59

  Fly    67 FQYKFDLDKQLNEDDRQFGEAEAKVVIDTVSLEYCSGATVDYHSELIRAGFRMVANPLAEQGCSC 131
            ..|..|..|...:.|.:..:...:|.|:..:.....|..:|:....:.:.| :..||..:..|.|
Zfish    60 LTYTLDYTKNKEQSDEEVLQDGVRVFIEKKAQLTLLGTEMDFVETKLSSEF-VFNNPNIKGTCGC 123

  Fly   132 GSSFSI 137
            |.||:|
Zfish   124 GESFNI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13623NP_651267.1 TIGR00049 36..137 CDD:272875 24/100 (24%)
isca1NP_001020349.1 IscA 24..129 CDD:440085 26/113 (23%)

Return to query results.
Submit another query.