DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6607 and ckap4

DIOPT Version :9

Sequence 1:NP_651266.1 Gene:CG6607 / 42925 FlyBaseID:FBgn0039204 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_998430.1 Gene:ckap4 / 406549 ZFINID:ZDB-GENE-040426-2417 Length:421 Species:Danio rerio


Alignment Length:221 Identity:62/221 - (28%)
Similarity:102/221 - (46%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEAKYQKLATEYSKLRAQATVLKKAVLEEQSKEASLREQLQQYATSLRRTEQEVDSLGFRNKQ- 75
            ||.|..|:|.|    :.:..|||..|....:...|.||||:...:..|:...:||.|:....|. 
Zfish   210 VPAALTQQLNT----ISSAITVLNTANEVSEGNAAVLREQISAVSAELQTRNREVQSVSEEIKAM 270

  Fly    76 ---LESRVSQLQQEISVHEQPKKKDKDSGGRRGVQSNSRPDADPSLDA-AQEALIFEELQKKIME 136
               ::|.|..|::|.|......:...|......::.:...||..|||. ..:.|:..||:.|..|
Zfish   271 RTLIQSTVGSLRKEASEARSSAQTSADQAQSFILKQDQLSDALHSLDTRLTDGLLKLELRLKTAE 335

  Fly   137 NA-QLTSLIDDKQRDLLLHTERIASLEQK----LEKRIGDQNELEKRLRKEVETLQHRNSELETK 196
            :: |||.:  ....|.|:...|  :||::    .|||..|..||..|: :|::.||....|:.|:
Zfish   336 DSQQLTDI--SSTLDALVSQHR--ALEERRTEDAEKRSADLQELRSRI-EELQRLQAAVEEIRTR 395

  Fly   197 L--VDAASMLGSEDALSATGSDTTPL 220
            |  ::.::...||:....|.|.:.|:
Zfish   396 LQELENSTESPSEEKSKPTQSPSGPV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6607NP_651266.1 KLRAQ 18..115 CDD:287210 24/100 (24%)
TTKRSYEDQ <233..402 CDD:287216
ckap4NP_998430.1 SMC_prok_B <87..384 CDD:274008 52/182 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.