DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6607 and Golga5

DIOPT Version :9

Sequence 1:NP_651266.1 Gene:CG6607 / 42925 FlyBaseID:FBgn0039204 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001185933.1 Gene:Golga5 / 27277 MGIID:1351475 Length:729 Species:Mus musculus


Alignment Length:408 Identity:97/408 - (23%)
Similarity:172/408 - (42%) Gaps:68/408 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPEAKYQKLATEYSKLRAQATVLKKAVLEEQSKEASLREQLQQYATSLRRTEQEVDS-LGFRNKQ 75
            |..:|..::..|   ||||...|.:||..:.|:.|.|:.:|           ||.|. |..|.:.
Mouse   269 VDNSKSDRITRE---LRAQVDDLTEAVAAKDSQLAVLKVRL-----------QEADQVLSSRTEA 319

  Fly    76 LESRVSQLQQEISVHEQPKKKDKDSGGRRGVQS--NSRPDADPSLDAAQEALIFEELQKKIMENA 138
            ||:..|:..:.:..|     |:..|...:.:|:  ....:||.:|...||:  ::::|.:..  |
Mouse   320 LEALRSEKSRIMQDH-----KEGSSLQNQALQTLQERLHEADATLKREQES--YKQMQSEFA--A 375

  Fly   139 QLTSLIDDKQRDLLLHTERIASLEQKLEKRIGDQNELEKRLRKEVETLQHRNSELETKLVDAASM 203
            :|..:..|:|.    ..|.:...|:|..:.....:||:::::....:|:....||......|..:
Mouse   376 RLNKMEVDRQN----LAEAVTLAERKYSEEKKKVDELQQQVKLHRASLESAKQELVDYKQKATRI 436

  Fly   204 LGSEDALSATGSDTTPLHNLQQQSNSNQLTSEDRIALLEKEAAHWRAQFEVAKLHQAFVSNPSKD 268
            |.|::.|..:..:.:....|:..:.|:....|.|   .|||......|..:.::||  :.:..:|
Mouse   437 LQSKEKLINSLKEGSSFEGLESSTASSMELEELR---HEKEMQKEEIQKLMGQMHQ--LRSELQD 496

  Fly   269 LSTCSCSTAAAGVTVRPAESEAKGSQRARDSLQD-----------PPEPPTKEQLIYSVFSKKFE 322
            :.....|.|                :.||:.|||           ..|..|:.:.:...|....|
Mouse   497 MEAQQVSEA----------------ESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEE 545

  Fly   323 DLMRLKVQAESKLRSYELEVQHLQNCLENAT------HELKAKDDQLASLGGALQMLEEELTTTR 381
            ||.|.|...:|:::..|.|:|.|:|.|.|.|      .||:::..||.......|.:.|.|:|.:
Mouse   546 DLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQTMLESLSTEK 610

  Fly   382 INYEEQISVLTEQVISLS 399
            .:...|:..|.:||.|.|
Mouse   611 NSLVFQLERLEQQVHSAS 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6607NP_651266.1 KLRAQ 18..115 CDD:287210 24/99 (24%)
TTKRSYEDQ <233..402 CDD:287216 47/184 (26%)
Golga5NP_001185933.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..222
Smc <231..565 CDD:224117 76/343 (22%)
Golgin_A5 418..723 CDD:370692 56/232 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 626..645 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.