DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG11852

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:262 Identity:71/262 - (27%)
Similarity:124/262 - (47%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMLLLIAAVAQE-LTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQ-LKAGNREFGIPPLEP 70
            :|||.:..||.. ..|:.|...|...|:|.....  .|:::..::.|:| .:.|....|.|.:||
  Fly     1 MMLLQLGCVALFCCLVSGASNFPPELPRCHMGDT--SCIINVSHMLIRQHARTGYPSAGFPQVEP 63

  Fly    71 LTVKKL-VIDAGNAPINLRQALKNVKVHDMIS--------------TSKIQRYRTDLDKHLIICD 120
            ..:|:. :.|.....:||:...::|.|..:.|              |||.:.|            
  Fly    64 FLIKRFDISDGRTGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMY------------ 116

  Fly   121 SRTDRIEMIGDYEMSGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFD 185
            ....:|.:.|.|...||||:|||.|.|.|.:.|.|.|...:......:::|..|:.:...:|..:
  Fly   117 GSFPKIVLKGKYVADGRILILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVE 181

  Fly   186 PKRVYMNFENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNI 249
            |:::.:..||||| |:.|...:|:|||:||..|:|||......:...|.:.:.::||::..::::
  Fly   182 PQKMNIRLENLFNGDQALGTNLNQFLNDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAYEDL 246

  Fly   250 FL 251
            ||
  Fly   247 FL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 66/255 (26%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.