DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG15497

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650976.1 Gene:CG15497 / 42552 FlyBaseID:FBgn0038894 Length:260 Species:Drosophila melanogaster


Alignment Length:277 Identity:58/277 - (20%)
Similarity:108/277 - (38%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYS------LLLMLLLIAAVAQELTVTAAQ-----ELPEGFPKCK-RDANFDKCLVDAVNVAI 53
            ||:.|      ||:.|..|:..|..|...::|     :|.....:|. .|.:|::|:....|...
  Fly     1 MSQQSLSNCARLLVYLAGISLFANHLANASSQIDVDTDLKHLLGRCHWSDEDFNECMRQVFNDLR 65

  Fly    54 QQLKAGNREFGIPPLEPLTVKKLVIDAGNAP--INLRQALKNVKVHDMISTSKIQRYRTDLDKHL 116
            .....|..::.|.|.:|.....:.:..|.:.  .:.|..|:||..:.. :.|::.::..|.:...
  Fly    66 AYFTTGVPDYNIKPFDPHHCSYVELRRGESQGLGSFRLILRNVSEYGW-ARSEVTKFHADPEDQR 129

  Fly   117 IICDSRTDRIEMIGDYEMSGRILLLPITGHGKANVTLIN----TKIEHRLIGEP-------FEKD 170
            |:.........:.|:||.:.::|...:...|..|:||.:    |.:  |.||.|       .|.|
  Fly   130 IVYTQYFPDKSLEGEYEFAAKMLGTEMNRKGHWNLTLYDYSQTTSV--RRIGGPGSLIKVHVEVD 192

  Fly   171 GVKYMRLKDYRVSFDPKRVYMNFENLFNDKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRE 235
            .:..|.|              :.|||...:.|:...:..:|..|:.....:|....:.....|.:
  Fly   193 RIGGMEL--------------HIENLLQGQPLNQLADGVINSMWQLGLPFIKPMINELVSTAFTD 243

  Fly   236 LSNKLFEKVPFDNIFLS 252
            :.|:.|...|.:. ||:
  Fly   244 IFNESFRHFPLEK-FLA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 50/256 (20%)
CG15497NP_650976.1 JHBP 26..258 CDD:284096 48/249 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.