DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG17279

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_650937.3 Gene:CG17279 / 42489 FlyBaseID:FBgn0038850 Length:245 Species:Drosophila melanogaster


Alignment Length:230 Identity:51/230 - (22%)
Similarity:107/230 - (46%) Gaps:10/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ELPEGFPKCKRDANFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKKLVIDA----GNAPINL 87
            :||....||:  |....|:.:.|...::....|....|:..|:.:..:.:|:..    |::..:|
  Fly    18 QLPPEIEKCR--AGDSICIAETVTRILRLYPKGLPSIGLVALDSIGFEDVVVSRLEPDGSSTFDL 80

  Fly    88 RQALKNVKVHDMISTSKIQRYRTDLD-KHLIICDSRTDRIEMIGDYEMSGRILLLPITGHGKANV 151
            :  ..|:.|.....::..:....|.| ..::........:::.|.|||.|.:|.:||.|.|:|.|
  Fly    81 K--FPNLTVIGFADSTVTEAKGFDADLPRVLELSGWIPLLKLNGTYEMRGSLLTMPIHGKGQAKV 143

  Fly   152 TLINTKIEHRL-IGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFNDKTLSDGMNRFLNENWE 215
            .:...::..:: :.|....||..|..:...:...|.:.:::|.|||||:..:||.||...|..|.
  Fly   144 EIRECRVRCKVRVLEDLRDDGKLYAGISKVKCLLDVQGMHLNLENLFNNPEMSDAMNVVANTKWL 208

  Fly   216 TVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF 250
            .:::.|:.|...:...:...:..::..|:|:|:::
  Fly   209 EIWHNLRRGITSAVDQLVESILQRVANKLPYDDLY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 51/230 (22%)
CG17279NP_650937.3 JHBP 5..243 CDD:336447 51/228 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.