DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG7079

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 / 42488 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:111/249 - (44%) Gaps:40/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QELPEGFPKCKRDANF--DKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKK--LVIDA--GNA- 83
            |:||....||    :|  .||||::.|..::....|..|..:.|...|:|:.  ||.|:  |.| 
  Fly    20 QKLPAKVKKC----HFGDGKCLVESANALLRDFPKGIPEVDLKPFNVLSVRDWLLVNDSQVGGAW 80

  Fly    84 ----PIN-LRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRIL-LLP 142
                .|| :....:|..:      ::|:.:..|.....|....:..|:...|||...||:| .:.
  Fly    81 YYFNLINQINYGFENTTI------TEIRGFDKDPTTTKIEIHGKIPRLVYKGDYVAKGRMLWFVD 139

  Fly   143 ITGHGKANVTLIN--------TKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFND 199
            |...|.:....:|        .::|:|        :..:|:::.:...:....|..|..:|.|.|
  Fly   140 IHSQGTSESDFLNFQFVLTLKVRVEYR--------NNKRYLKIYELVPNIRLDRWIMWLDNFFPD 196

  Fly   200 -KTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIFLS 252
             :.|:..:|...|.||...:|||:.|..:.|..:|..|...||||||:|::||:
  Fly   197 NEDLTIAVNNLFNRNWVEFWNELEPGILRLFETVFLSLFEDLFEKVPYDDLFLA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 64/246 (26%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.