DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG10407

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001303466.1 Gene:CG10407 / 41949 FlyBaseID:FBgn0038395 Length:263 Species:Drosophila melanogaster


Alignment Length:261 Identity:79/261 - (30%)
Similarity:133/261 - (50%) Gaps:13/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYSLLLMLLLIAAVAQELTVTA------AQELPEGFPKCKRDA-NFDKCLVDAVNVAIQQLKA 58
            |::|.|..:||::..|......||      |.:||.....|.|:| :.|.|:.::......:|..
  Fly     1 MNQYFLTGLLLVLGVVLHIDWTTAKPPAKKADQLPSFLKVCHRNAPDLDTCVRESYEELRPRLME 65

  Fly    59 GNREFGIPPLEPLTVKKLVIDAGNAPINLRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRT 123
            |..|..||.:|||.|.::.:|..:..|.|....:||||.. ||...:...|.:..|...|.....
  Fly    66 GIPELYIPAMEPLVVPQVKMDQDSGAIYLHSVYRNVKVTG-ISKHTVNELRLEPSKLKFILSLTF 129

  Fly   124 DRIEMIGDYEM----SGRILLLPITGHGKANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSF 184
            .::.|..||.:    .|:|:::|:.|.|...|.|:|..:...|||:.::|:|..::::...:|.:
  Fly   130 PKLHMESDYSIKVSREGKIMMMPLLGDGHCKVDLVNITMRTELIGQEYKKNGANFLKINTVKVKY 194

  Fly   185 DPKRVYMNFENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDN 248
            :...|:::.:|||| ||.|.|.||.||||||:.:..|::....|:...|.|...:|||....:|:
  Fly   195 ELSDVHIHLDNLFNGDKALGDRMNEFLNENWKALAEEVRPLMTKALVDILRASVDKLFASFSYDD 259

  Fly   249 I 249
            :
  Fly   260 L 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 74/249 (30%)
CG10407NP_001303466.1 JHBP 28..262 CDD:284096 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.