DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG1124

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:250 Identity:59/250 - (23%)
Similarity:109/250 - (43%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLKA----GNREFGIPPLEPLTV 73
            :..|.|.|.:..| |.|....:|.|:   |..|||....||:.||.    |..:..:|.:||..:
  Fly     7 LVIVIQALRMVQA-ETPPYIKQCHRN---DPKLVDCFIGAIEHLKPYLANGIPDIQLPSVEPFKM 67

  Fly    74 KKLVIDAGNAPINLRQALKNVKV----HDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEM 134
            ..|.:.....|...:..|||::.    :..:::.|:..........:::     .::::...|..
  Fly    68 DTLALQLTEGPQGYKITLKNMEAFGASNFKVTSLKLSEGSEPFKAKIVM-----PKLKIEAKYTS 127

  Fly   135 SGRILLLPITGHG--KANVTLINTKIEHRLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLF 197
            ||.:|:||.:|.|  .||...::..:..:.....|:  |..|:.:....:..|.|.|.|:....|
  Fly   128 SGVLLILPASGGGDFHANFEGVSADLTGKTSIHAFK--GANYLHIDALSLVLDVKDVKMSISGAF 190

  Fly   198 -NDKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIFL 251
             |::.|.:..|.||.||.:.|...::....|.....|.:|:|:|.:.||.:..::
  Fly   191 NNNRILLEATNLFLRENSQVVLEAMQAQLQKKLASEFGKLANQLLKNVPVEQFYV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 59/248 (24%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 59/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.