DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG14457

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 / 40479 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:123/271 - (45%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKYSLLLMLLLIAAVAQELTVTAAQELPEGFPKCK-RDANFDKCLVDAVNVAIQQLKAGNREFG 64
            |::..|:::|:..............:|.|:...:|: .|.:|..|...::.....:|..     |
  Fly     1 MARLELIVLLVTFTTCLVRAEDGFLKEPPDYIKECRIADKDFVNCSTHSIQQLFDKLND-----G 60

  Fly    65 IPPL------EPLTVKKLVIDAGNA-PINLRQALKNVKV----HDMISTSKIQRYRTDLDKHLII 118
            ||.|      :|..:.::.|..||: .|||:..|.|||:    |..:..|::  ::.|.......
  Fly    61 IPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQV--FKKDYSWKTTF 123

  Fly   119 CDSRTDRIEMIGDYEMSGRILLLPITGHGKA-----NVTL-INTKIEHRLIGEPFEKDGVKYMRL 177
               ....:::..||.:.|||||:|:.|.|:.     |:|: ::||.  ||    :.|.|..:..:
  Fly   124 ---TLPEMKLQADYSLFGRILLIPLNGKGQVFLDAENMTVTMHTKT--RL----YSKGGFTFYNV 179

  Fly   178 KDYRVSFDPKRVYMNFENLFN-DKTLSDGMNRFLNENWETVFNELKVGYAKSFGIIFRELSNKLF 241
            .:..|.|....:...|.|||| :|.|.|..|:|.|:||..:.:.|.....::...|..::..|:|
  Fly   180 TNLHVDFKMDGLKSYFSNLFNGNKQLEDSTNKFFNDNWRMLADALYTVITQTIEDILLDVLKKIF 244

  Fly   242 EKVPFDNIFLS 252
            ..:| .|.|:|
  Fly   245 HFIP-ANFFVS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 64/256 (25%)
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.