DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG33680

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 / 3771724 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:84/221 - (38%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PKCKRDANFDKCLVDAVNVAIQQLKAGNREFGIP--PLEPLTVKKLVIDAGNAPINLRQALKNVK 95
            |..:.:...::|:::|.......|..||...|.|  |||||                  :|.|: 
  Fly    37 PCARNEPLLERCIINAAYQIRPLLVHGNLGDGFPTSPLEPL------------------SLDNI- 82

  Fly    96 VHDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRILLLPITGHGKANVTLINTKIEH 160
              ::..:|:.|....||:         .:.....|.|.:...:||..|.|.|.......|.|...
  Fly    83 --ELKLSSQFQAVFKDLE---------ANGGNYTGKYSLHLNLLLPDIKGKGNMQGYCENAKAFV 136

  Fly   161 RLIGEPFEKDGVKYMRLKDYRVSFDPKRVYMNFENLFN-DKTLSDGMNRFLNENWETVFNELKVG 224
            ::.|..:.::|..|::........|.|...:...|||: |:.|.|..|..:|.|.|....::...
  Fly   137 KIRGSRYLRNGKDYVKFSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDIAPS 201

  Fly   225 YAKSFGIIFRELSNKLFEKVPFDNIF 250
            ........|.::::|:.....||.:|
  Fly   202 LEHGLSKHFLDVADKILASATFDEMF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 48/221 (22%)
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 48/221 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.