DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and CG3246

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608781.2 Gene:CG3246 / 33564 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:95/258 - (36%) Gaps:78/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKKLV 77
            |||..:.:.|...||.|:|.|                              |:|..:||.|..:.
  Fly    49 IAAQVEAMLVHFQQEDPQGLP------------------------------GVPVPDPLEVPNVK 83

  Fly    78 IDAGNAPINLRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRILLLP 142
            ...|.|.::::|    ||.:. :|..:|.:...||.:.......:.|::.:.|.|.:|       
  Fly    84 KSMGMANLDMKQ----VKAYG-LSKFRIDKMNLDLKEMRFNGGLQLDQMLVKGQYTLS------- 136

  Fly   143 ITGHGKAN----VTLINTKIEHRLIGEPF---EKDGVKYMRLKDYRVSFDP--KRVYMNFENL-- 196
             :...|||    |.|.|...|    ...|   |:||    :|...|:..|.  ..:.|:|:||  
  Fly   137 -SFFSKANGPFTVVLKNVYAE----ATAFLAVERDG----QLATDRIKIDITFSDMTMDFQNLGL 192

  Fly   197 ----FND------KTLSDGMNRF-LNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDN 248
                |..      ..:.|.|..| |.|..:.:.:|:.|...|:.|  .|.|.|.:   .|.|:
  Fly   193 VGSVFQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTLG--ERRLPNSI---TPLDS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 60/258 (23%)
CG3246NP_608781.2 JHBP 31..246 CDD:214779 58/252 (23%)
Grp7_allergen 260..418 CDD:293589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.