DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13618 and dyw

DIOPT Version :9

Sequence 1:NP_651265.1 Gene:CG13618 / 42924 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_570016.1 Gene:dyw / 31252 FlyBaseID:FBgn0000092 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:65/250 - (26%)
Similarity:123/250 - (49%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VTAAQELPEGFP----KCK-RDANFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKKLVIDAG 81
            |:...:..||||    :|| :|   :.||:.......|..|.|..|..:..|||:.:..:.|::|
  Fly    19 VSCRVDASEGFPSPLKRCKLQD---ESCLLAQAQTFFQAFKNGIPERQVAALEPIALGTMFIESG 80

  Fly    82 --NAPINLRQALKNVKVHDMIST---SKIQRYRTDLDKHL---IICDSRTDRIEMIGDYEMSGRI 138
              :..|..:..:.:.|::::.::   ..::.:..||.:.|   ::.|:  ..:|:...|::.|::
  Fly    81 GHSESIKFKLTMSDAKLYNLANSMMVKSLKGFTKDLTRPLKLTLLLDN--PELEVRAKYDVDGKL 143

  Fly   139 LLLPITGHGKANVTL--INTKIEHRLIGEPFEK-DGVKYMRLKDYRVSFDPKRVYMNFENLFND- 199
            |:|||...|...:.|  ::||:  .:..||.:: ||..|:.:.||:.:...|..:.:..||||| 
  Fly   144 LILPIVSKGDLTIRLNDVHTKV--WITAEPVKRSDGHTYLNITDYKTATKIKGGHFDLSNLFNDN 206

  Fly   200 KTLSDGMNRFLNENWET----VFNELKVGYAKSFGIIFRELSNKLFEKVPFDNIF 250
            |.|.|...:.||:.|.|    |..::....||:|..|.:    .|:..:|:|..|
  Fly   207 KELRDSTLKVLNQEWSTLALDVQPKINEACAKAFSAIVQ----SLWANIPYDEFF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13618NP_651265.1 JHBP 13..251 CDD:284096 64/249 (26%)
dywNP_570016.1 JHBP 29..258 CDD:214779 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CDJY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.