DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and CMP2

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_013655.1 Gene:CMP2 / 854946 SGDID:S000004521 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:111/308 - (36%)
Similarity:170/308 - (55%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNY 85
            |.||   ||.::...:...:.|:|..:|.|:.:.||:.:||||||||:|||:|||.||.|..::|
Yeast   106 REGK---LSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTSY 167

  Fly    86 LFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTF 150
            ||||||||||..|.|.:..|.:.|:.:.::|:||||||||..:...:.|.:|...:|.:.:::..
Yeast   168 LFLGDYVDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKC 232

  Fly   151 TDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDP-------- 207
            .:.||.||:||:::.:..|.|||:||:|:|::.|..:.|..::|..||:|||||:||        
Yeast   233 CESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVL 297

  Fly   208 DKDTMGWGEND--------------------------RGVSFTFGAEVVGKFLQKHEFDLICRAH 246
            |||..   |.|                          ||.|:.|.......|||:.....|.|||
Yeast   298 DKDLT---EEDIVNSKTMVPHHGKMAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAH 359

  Fly   247 QVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDDTLM 288
            :..:.||..:...:      |:||||||||...::|..|::..::.:|
Yeast   360 EAQDAGYRMYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAILKYENNVM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 111/308 (36%)
CMP2NP_013655.1 MPP_PP2B 95..423 CDD:277361 111/308 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.