DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and SIT4

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_010236.1 Gene:SIT4 / 851513 SGDID:S000002205 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:122/276 - (44%)
Similarity:181/276 - (65%) Gaps:6/276 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFE-YGGFPPESNYLFLGDY 91
            |:|:|::.||...:|:.:.:..:..::.|:.:|||||||::|||.||. .||||.:.||:|||||
Yeast    19 LTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDY 83

  Fly    92 VDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFN 155
            ||||..||||..||:..|:||.....|:|||||...|.::||||:||..:| :..:||.....|:
Yeast    84 VDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFD 148

  Fly   156 CLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRG 220
            .|.:|||:|.||.|.||||||::..::|||.:.|..:||.:|...|||||||| :...|..:.||
Yeast   149 FLTLAAIIDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPD-NVEAWQVSPRG 212

  Fly   221 VSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEF-FAKRQLVTLFSAPNYCGEFDNAGAMMSVD 284
            ..:.||::|..:|...:..:||.||||:|.:|::: |.::.:||::||||||....|..::|.||
Yeast   213 AGWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKVD 277

  Fly   285 DTLMCSFQILK--PAD 298
            :.|..:|:|..  |.|
Yeast   278 EDLEPTFKIFSAVPDD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 120/272 (44%)
SIT4NP_010236.1 MPP_PP2A_PP4_PP6 7..291 CDD:277360 120/272 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.