DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and PPH21

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:136/316 - (43%)
Similarity:195/316 - (61%) Gaps:23/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQ 66
            ::|..:|..|..|        .|...|||.::..||..:.::...:..:..:..|:.||||:|||
Yeast    65 TNINQLDQWIEHL--------SKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQ 121

  Fly    67 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRI 131
            ::|||.||:.||..|::||||:|||||||..|:||:..|:|.|::|.....:||||||...|.::
Yeast   122 FHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQV 186

  Fly   132 YGFYDECKRRY-TIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPD 195
            |||||||.|:| :..:||.|||.|:..|:.|:||.||||.||||||.:.:::|:|.:.|..:||.
Yeast   187 YGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPH 251

  Fly   196 QGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQ 260
            :|.:||||||||| |..|||.:.||..||||.:|..:|...::..||.||||:|.:||.:..::.
Yeast   252 EGPMCDLLWSDPD-DRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQN 315

  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFGSSGRPLTP 316
            :||:|||||||....|..|:|.||:.           ..|:|:  .:..|.||..|
Yeast   316 VVTIFSAPNYCYRCGNQAAIMEVDEN-----------HNRQFL--QYDPSVRPGEP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 129/290 (44%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 131/303 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.