DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and CNA1

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:110/282 - (39%)
Similarity:165/282 - (58%) Gaps:20/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY 91
            :||:.:...:...|......:|.||:|:||:.|||||||||||||:|||.||.|.|.:|||||||
Yeast    84 RLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDY 148

  Fly    92 VDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNC 156
            ||||..|.|.:..|.:.|:.....|::|||||||..:...:.|.:|...:|.::::......||.
Yeast   149 VDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNV 213

  Fly   157 LPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDP--------DKDTMG 213
            ||:||:::.:.||.|||:||:|.|:|.:.:|.|..::|.:||:|||||:||        |.....
Yeast   214 LPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFD 278

  Fly   214 WGEND------RGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQ------LVTLFS 266
            ..|::      ||.||.|..:...|||:.:....|.|||:..:.||..:...:      |:|:||
Yeast   279 QSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMFS 343

  Fly   267 APNYCGEFDNAGAMMSVDDTLM 288
            ||||...:.|..|::..::.:|
Yeast   344 APNYLDTYHNKAAVLKYEENVM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 110/282 (39%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 110/282 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.