DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and TOPP3

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_176587.1 Gene:TOPP3 / 842708 AraportID:AT1G64040 Length:322 Species:Arabidopsis thaliana


Alignment Length:320 Identity:232/320 - (72%)
Similarity:271/320 - (84%) Gaps:7/320 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|.:|.|||..:..:..|.|||:|:||:.||..:::|||:||.|||||||:|||||.|||:.|||
plant     6 VDDVIKRLLGAKNGKTTKQVQLTEAEIKHLCSTAKQIFLTQPNLLELEAPIKICGDTHGQFSDLL 70

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYD 136
            |||||||:||.:|||||||||||||||:|||||||||||||.|||||||||||||||||||||||
plant    71 RLFEYGGYPPAANYLFLGDYVDRGKQSVETICLLLAYKIKYKENFFLLRGNHECASINRIYGFYD 135

  Fly   137 ECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCD 201
            |||:||::::||.||||||||||||::||||.|.||||||:|..:::||.|.||.|:||.|||||
plant   136 ECKKRYSVRVWKIFTDCFNCLPVAALIDEKILCMHGGLSPELKHLDEIRNIPRPADIPDHGLLCD 200

  Fly   202 LLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFS 266
            |||||||||..||||||||||:||||:.|.:|||.|:.||||||||||||||||||.|||||:||
plant   201 LLWSDPDKDIEGWGENDRGVSYTFGADKVEEFLQTHDLDLICRAHQVVEDGYEFFANRQLVTIFS 265

  Fly   267 APNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFG---SSGRPLTPPRGANNK 323
            |||||||||||||||||||:|.|||||||.::|:    .|||   ::||..||||....|
plant   266 APNYCGEFDNAGAMMSVDDSLTCSFQILKASEKK----GNFGFGKNAGRRGTPPRKGGGK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 220/288 (76%)
TOPP3NP_176587.1 MPP_PP1_PPKL 5..294 CDD:277359 219/287 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.