DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and TOPP7

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_567375.1 Gene:TOPP7 / 826726 AraportID:AT4G11240 Length:322 Species:Arabidopsis thaliana


Alignment Length:312 Identity:231/312 - (74%)
Similarity:271/312 - (86%) Gaps:3/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|.||.|||.....|..|..|::|:|||.|||.|:|:|||||.|||||||:|||||:|||:.|||
plant     6 LDDIIRRLLATNNGRTVKQAQITETEIRQLCLASKEVFLSQPNLLELEAPIKICGDVHGQFPDLL 70

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYD 136
            |||||||:||.:|||||||||||||||:||||||||||:||..||||||||||||||||:|||||
plant    71 RLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRGNHECASINRVYGFYD 135

  Fly   137 ECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCD 201
            ||||||.::||||||:|||||||:|::|:||.|.|||||||:.|::.||||.||.||||||:|||
plant   136 ECKRRYNVRLWKTFTECFNCLPVSALIDDKILCMHGGLSPDIKSLDDIRRIPRPIDVPDQGILCD 200

  Fly   202 LLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFS 266
            |||:|||::..||||||||||:||||:.|.:|||.|:.||||||||||||||||||||||||:||
plant   201 LLWADPDREIQGWGENDRGVSYTFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQLVTIFS 265

  Fly   267 APNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR-RFVYPNFGSSGRPLTPP 317
            |||||||||||||:|||||:|.|||||||.::|: ||.:.|  :..||.|||
plant   266 APNYCGEFDNAGALMSVDDSLTCSFQILKASEKKGRFGFNN--NVPRPGTPP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 221/288 (77%)
TOPP7NP_567375.1 MPP_PP1_PPKL 6..294 CDD:277359 220/287 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 107 1.000 Domainoid score I2174
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.