DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:298 Identity:178/298 - (59%)
Similarity:226/298 - (75%) Gaps:5/298 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|.:|:.||..:..|   .:.:.||:|..|..::|::.:|:|:||.:|||:.:.|||||||.|||
  Fly    17 LDEMIASLLSWKIDR---KMMVPESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLL 78

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYD 136
            |.||..|.||:..||.|||||||||.|:||:.||||||::|..:..|||||||.|:|||.|||||
  Fly    79 RYFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYD 143

  Fly   137 ECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCD 201
            |||||:||:||:.|.||::|||||||::.|||||||||||.|.::..|:.:.||.:|...|||||
  Fly   144 ECKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCD 208

  Fly   202 LLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFS 266
            |||||||...:||.:|.||||||||.::|..||.:..|||||||||||||||||||||||:|:||
  Fly   209 LLWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFS 273

  Fly   267 APNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVY 304
            |.|||||||||||||.||..|..:..::||  |:|..:
  Fly   274 AVNYCGEFDNAGAMMCVDAELNITLVVMKP--KKRIAF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 174/288 (60%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 174/288 (60%)
PP2Ac 36..305 CDD:197547 171/270 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.