DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Ppp4c

DIOPT Version :10

Sequence 1:NP_524484.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_062648.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:50 Identity:15/50 - (30%)
Similarity:21/50 - (42%) Gaps:18/50 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KARWYTARRSTIHEQGGQLFMVIVLLCICGTTIVKVACNRTNSKLTAIPI 55
            |.||            .||.:.||||.|.|.|:.::..|      .::||
Mouse  1696 KDRW------------NQLDLAIVLLSIMGITLEEIEVN------ASLPI 1727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_524484.1 MPP_PP1_PPKL 6..296 CDD:277359 14/49 (29%)
Ppp4cNP_062648.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.