DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and PPP6C

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:284 Identity:125/284 - (44%)
Similarity:175/284 - (61%) Gaps:11/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLE 100
            ||....::.|.:..:..:..|:.:|||||||:|||..||..||..|::||:|:||:||||..|||
Human    64 LCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLE 128

  Fly   101 TICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNCLPVAAIVD 164
            |...|||.|.|:.:...|||||||...|.::|||||||:.:| ....|:..|..|:.|.|||::|
Human   129 TFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALID 193

  Fly   165 EKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDP-DKDTMGWGENDRGVSFTFGAE 228
            |:|.|.|||||||:.:::|||.|.|..::|.:|..|||:|||| |.||  |..:.||..:.|||:
Human   194 EQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDT--WAISPRGAGWLFGAK 256

  Fly   229 VVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQI 293
            |..:|:..:...|||||||:|.:||:|....:|||::||||||....|..::|...|......::
Human   257 VTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKL 321

  Fly   294 LKPA-DKRRFVYPNFGSSGRPLTP 316
            .:.. |..|.:.|      |..||
Human   322 FRAVPDSERVIPP------RTTTP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 119/261 (46%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 119/263 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.