DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and PPP5C

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_016882424.1 Gene:PPP5C / 5536 HGNCID:9322 Length:551 Species:Homo sapiens


Alignment Length:277 Identity:114/277 - (41%)
Similarity:162/277 - (58%) Gaps:19/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAY 108
            |.:..|.|.| .:.:|||.|||:||||.:||..|.|.|:| |:|.||:||||..|:|.|..|..:
Human   226 LVETTLKETE-KITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGF 289

  Fly   109 KIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGG 173
            |:.|.::|.|||||||..::|:||||..|.|.:||.::::.|::.|..||:|..::.|:...|||
Human   290 KLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGG 354

  Fly   174 L-SPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKH 237
            | |.|..:::.||:|.|....||.|.:||||||||.... |...:.||||..||.:|...||:::
Human   355 LFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQN-GRSISKRGVSCQFGPDVTKAFLEEN 418

  Fly   238 EFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRF 302
            ..|.|.|:|:|..:|||.....:.||:|||||||.:..|           ..|:..|:.:|.|  
Human   419 NLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGN-----------KASYIHLQGSDLR-- 470

  Fly   303 VYPNFGSSGRPLTPPRG 319
              |.|......::.|.|
Human   471 --PQFHQFTAVVSHPSG 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 108/252 (43%)
PPP5CXP_016882424.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.