DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and PPP4C

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001290432.1 Gene:PPP4C / 5531 HGNCID:9319 Length:307 Species:Homo sapiens


Alignment Length:298 Identity:135/298 - (45%)
Similarity:202/298 - (67%) Gaps:10/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHG 65
            |::|.::|..|.:|....        .:.|||:::||.|:|||.:.:..:..:::|:.:||||||
Human     1 MAEISDLDRQIEQLRRCE--------LIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHG 57

  Fly    66 QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINR 130
            |:|||..||..||..||:||||:||:||||..|:||..||||.|::|.:...|:|||||...|.:
Human    58 QFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQ 122

  Fly   131 IYGFYDECKRRY-TIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVP 194
            :|||||||.|:| ::.:|:..|:.|:.|.::||:|.||||.||||||.:.:::|||.|.|..:||
Human   123 VYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVP 187

  Fly   195 DQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKR 259
            ..|.:||||||||: ||.|||.:.||..:.||::||.:|...::.|:||||||:|.:||::....
Human   188 HDGPMCDLLWSDPE-DTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNE 251

  Fly   260 QLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPA 297
            .::|::||||||....|..|::.:|:.|...|.|.:.|
Human   252 TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 132/290 (46%)
PPP4CNP_001290432.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 133/293 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.