DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and PPP2CB

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001009552.1 Gene:PPP2CB / 5516 HGNCID:9300 Length:309 Species:Homo sapiens


Alignment Length:295 Identity:138/295 - (46%)
Similarity:197/295 - (66%) Gaps:10/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|..:.:|.|.:        ||:|:::|:||.|::||...:..:.|:..|:.:|||:|||::||:
Human    10 LDQWVEQLNECK--------QLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLM 66

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYD 136
            .||..||..|::||||:|||||||..|:||:.||:|.|::|.|...:||||||...|.::|||||
Human    67 ELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYD 131

  Fly   137 ECKRRY-TIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLC 200
            ||.|:| ...:||.|||.|:.||:.|:||.:|||.||||||.:.:::.||.:.|..:||.:|.:|
Human   132 ECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMC 196

  Fly   201 DLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLF 265
            |||||||| |..|||.:.||..:|||.::...|...:...|:.||||:|.:||.:...|.:||:|
Human   197 DLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIF 260

  Fly   266 SAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300
            ||||||....|..|:|.:||||..||....||.:|
Human   261 SAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 135/289 (47%)
PPP2CBNP_001009552.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 136/291 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.