DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Pp4-19C

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:320 Identity:137/320 - (42%)
Similarity:207/320 - (64%) Gaps:20/320 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDIMNIDSIISRLLEVRGARPGKNVQ-LSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIH 64
            |||..::|..|.:|         |..: :.|:|:::||.|:|||.:.:..:..:::|:.:|||||
  Fly     1 MSDYSDLDRQIEQL---------KRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIH 56

  Fly    65 GQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASIN 129
            ||:|||..||:.||..||.||||:||:||||..|:||..||||.|::|.:...|:|||||...|.
  Fly    57 GQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQIT 121

  Fly   130 RIYGFYDECKRRY-TIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDV 193
            ::|||||||.|:| :..:|:..|:.|:.|.::||:|.||||.||||||.:..::|||.|.|..:|
  Fly   122 QVYGFYDECLRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEV 186

  Fly   194 PDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAK 258
            |..|.:||||||||: |..|||.:.||..:.||::||.:|.:.::.|:||||||:|.:|:::...
  Fly   187 PHDGPMCDLLWSDPE-DQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFN 250

  Fly   259 RQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFGSSGRPLTPPR 318
            ..::|::||||||....|..|::.:::.|...|.|.:.|.:.        |.|.|...|:
  Fly   251 ETVLTVWSAPNYCYRCGNVAAILELNEYLHRDFVIFEAAPQE--------SRGIPSKKPQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 129/291 (44%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 129/293 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438745
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.