DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and CanA1

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster


Alignment Length:322 Identity:113/322 - (35%)
Similarity:176/322 - (54%) Gaps:37/322 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NIDSIISR-LLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            |.|::... |||.|         :.|:....:..:...:...:..::::|||:.:|||||||::|
  Fly    82 NFDALRQHFLLEGR---------IEEAVALRIITEGAALLREEKNMIDVEAPITVCGDIHGQFFD 137

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGF 134
            |::|||.||.|..:.|||||||||||..|:|.:..|.:.||.|.....||||||||..:...:.|
  Fly   138 LVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTF 202

  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLL 199
            ..||..:|:..::....:.|:|||:||:::::..|.||||||::.:::.|:.:.|..:.|..|.:
  Fly   203 KQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPM 267

  Fly   200 CDLLWSDPDKDTMGWGEND-------RGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFA 257
            ||||||||.:|......|:       ||.|:.|......:||||:....|.|||:..:.||..:.
  Fly   268 CDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYR 332

  Fly   258 KRQ------LVTLFSAPNYCGEFDNAGAMMSVDDTLM------CSFQILKPADKRRFVYPNF 307
            |.|      |:|:||||||...::|..|::..::.:|      ||        ...:..|||
  Fly   333 KNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS--------PHPYWLPNF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 110/309 (36%)
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 110/319 (34%)
PP2Ac 98..369 CDD:197547 101/270 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438758
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.