DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Ppef1

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:287 Identity:90/287 - (31%)
Similarity:140/287 - (48%) Gaps:40/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IRSLCLKSREIFLSQPILLELEA-PLK---ICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYV 92
            :..:..::|:|....|....::. |.|   ||||:||:..||:.:|...|.|.|.| |:|.||:|
  Rat   164 VLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFV 228

  Fly    93 DRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTI---KLWKTFTDCF 154
            |||..|:|.:.:||...:.|..:..|.|||||...:|..|||..|..::|.:   |:.:...:.:
  Rat   229 DRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELY 293

  Fly   155 NCLPVAAIVDEKIFCCHGGL--SPDLSSMEQIRR------IMRPTDVPDQ--------------- 196
            ..||:..|:|.:|...|||:  |.||:.::|::|      :|.|.....:               
  Rat   294 TWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSA 358

  Fly   197 ---------GLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDG 252
                     ..:.|||||||......:....||....||.:|..|.|.|::..::.|:|:...||
  Rat   359 SEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDG 423

  Fly   253 YEFFAKRQLVTLFSAPNYCGEFDNAGA 279
            ||.....:::|:|||.||..|..|.||
  Rat   424 YEICHDGKVITVFSASNYYEEGSNRGA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 90/287 (31%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 90/287 (31%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.