DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus


Alignment Length:323 Identity:275/323 - (85%)
Similarity:299/323 - (92%) Gaps:2/323 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :|:||:|:|||||||.||||.||::|:|:|.||:|||||||||||||||||||||||||||||.|
  Rat     6 LNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD 70

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGF 134
            |||||||||||||:|||||||||||||||||||||||||||||.|||||||||||||||||||||
  Rat    71 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 135

  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLL 199
            |||||||:.|||||||||||||||:|||||||||||||||||||.||||||||||||||||.|||
  Rat   136 YDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTL 264
            |||||||||||..|||||||||||||||:||.|||.:|:.|||||||||||||||||||||||||
  Rat   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR-RFVYPNFGSSGRPLTPPRGANNKNKK 326
            ||||||||||||||.|||||:|||||||||||::|: ::.|... :||||:||||.||...|:
  Rat   266 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGL-NSGRPVTPPRTANPPKKR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 260/289 (90%)
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 260/289 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.