DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:326 Identity:288/326 - (88%)
Similarity:303/326 - (92%) Gaps:8/326 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDI--MNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDI 63
            |:||  :||||||.|||||||::|||||||.|:|||.||||||||||||||||||||||||||||
Mouse     1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    64 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASI 128
            |||||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||
Mouse    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   129 NRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDV 193
            ||||||||||||||.|||||||||||||||:|||||||||||||||||||.||||||||||||||
Mouse   131 NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 195

  Fly   194 PDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAK 258
            |||||||||||||||||.:||||||||||||||||||.|||.||:.|||||||||||||||||||
Mouse   196 PDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK 260

  Fly   259 RQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFGSSGRPLTPPRGANNK 323
            ||||||||||||||||||||||||||:||||||||||||:|::   ||   :.||:||||..:..
Mouse   261 RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK---PN---ATRPVTPPRVGSGL 319

  Fly   324 N 324
            |
Mouse   320 N 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 272/289 (94%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 272/289 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 395 1.000 Domainoid score I758
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 602 1.000 Inparanoid score I936
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm8882
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - LDO PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.