DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and F44B9.9

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:292 Identity:94/292 - (32%)
Similarity:128/292 - (43%) Gaps:86/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFE-------------YGGFP 80
            |::|:..|.....|:|..:..|.|:..|:.|.||||||:.||:||..             | ||.
 Worm     5 SKTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIY-GFS 68

  Fly    81 PESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIK 145
            .: .::|||||||||.:||:.|||:.:.||.:.:.:.|||||||..:||..|||           
 Worm    69 TK-KWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF----------- 121

  Fly   146 LWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKD 210
                        .|.::|..||        |...|.  ||                         
 Worm   122 ------------RVCSVVVLKI--------PAKPSF--IR------------------------- 139

  Fly   211 TMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFD 275
                 .|.||:|..|....|.:..:.....||.|.||::..|::|||.|:|.|:||||.|..|.|
 Worm   140 -----NNKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEID 199

  Fly   276 NAGAMMSVDDTLMCSFQILKPADKRRFVYPNF 307
            |:||:|.|......|..|:|        .|||
 Worm   200 NSGAVMKVASNGKISISIMK--------NPNF 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 90/279 (32%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 90/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.