DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and gsp-1

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001256250.1 Gene:gsp-1 / 179486 WormBaseID:WBGene00001747 Length:329 Species:Caenorhabditis elegans


Alignment Length:310 Identity:263/310 - (84%)
Similarity:289/310 - (93%) Gaps:2/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :|||::|:|||||||.||||.|.:||:|||:||.|||||||||||||||||||||||||||||.|
 Worm     7 LNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYND 71

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGF 134
            |||||||||||||:||||||||||||||||||||||||||:||.|||||||||||||||||||||
 Worm    72 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGF 136

  Fly   135 YDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLL 199
            |||||||::|||||||||||||||:||::|||||||||||||||.:||||||:||||||||.|||
 Worm   137 YDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLL 201

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTL 264
            |||||||||||..||||||||||||||.:||.|||.:|:.|||||||||||||||||||||||||
 Worm   202 CDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR-RFVYPNFGSSGRP 313
            ||||||||||||||.|||||:|||||||||||::|: ::.|... :||||
 Worm   267 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYQGM-NSGRP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 255/289 (88%)
gsp-1NP_001256250.1 MPP_PP1_PPKL 8..298 CDD:277359 255/289 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.