DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1alpha-96A and C06A1.3

DIOPT Version :9

Sequence 1:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_496276.1 Gene:C06A1.3 / 174626 WormBaseID:WBGene00007354 Length:364 Species:Caenorhabditis elegans


Alignment Length:265 Identity:130/265 - (49%)
Similarity:176/265 - (66%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGK 96
            ||.|:......||:.:..|.|.|||:|:.||||.||.|:.|||:..|..||...:|||||||||.
 Worm    63 EIISIIRMVEAIFMEESNLCEAEAPIKVIGDIHAQYQDMNRLFDLIGRVPEEKLMFLGDYVDRGP 127

  Fly    97 QSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAA 161
            |.:|.:.||...||:|.:..:|||||||..|:|:|||||.||:.:|.|.||..|..|||.:|::.
 Worm   128 QGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKYGIGLWWDFQSCFNRMPMSG 192

  Fly   162 IVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFG 226
            ::.:::.|.||||||:|.:::.||.|.||.:..|:|||.|||||||.....||..:.||:|:.||
 Worm   193 LISKRVLCMHGGLSPELINLDTIRNIPRPCEPLDRGLLIDLLWSDPTNKGEGWFHSIRGISYMFG 257

  Fly   227 AEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSF 291
            ..||.:..:..|.|||.||||||:||||....|:|:|:||.||||.:|.||.|::.::..|..||
 Worm   258 KGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRLITVFSVPNYCAQFTNAAAVVCLNANLQISF 322

  Fly   292 QILKP 296
            |.:.|
 Worm   323 QQMIP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 129/263 (49%)
C06A1.3NP_496276.1 MPP_superfamily 37..327 CDD:301300 129/263 (49%)
PP2Ac 59..329 CDD:197547 130/265 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.