DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRbeta2 and htr3b

DIOPT Version :9

Sequence 1:NP_524483.1 Gene:nAChRbeta2 / 42920 FlyBaseID:FBgn0004118 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_021324909.1 Gene:htr3b / 571632 ZFINID:ZDB-GENE-071012-4 Length:369 Species:Danio rerio


Alignment Length:346 Identity:108/346 - (31%)
Similarity:186/346 - (53%) Gaps:28/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVPLANSTAPISFEANPD------TKRLYDDLLSNYNRLIRPVVNNTETLTVWLGLKLSQLIEV 69
            ||:.|..|..|:: |..|:      ..:|...||..||..:|||.|.|:..|:::.|.:..:::|
Zfish     5 LLLSLLLSVIPLA-ELVPEKPKRSALNQLTRLLLRKYNCGVRPVQNWTKPTTIYIDLIIQAVLDV 68

  Fly    70 NLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWD-GNYEVTLMTK 133
            :.:.|.:||::|.:|.|.|..|.|||:|:.|:.::.:.|:.|||||:::....| |...|  :..
Zfish    69 DGQTQKVTTSIWYRQIWNDEFLVWDPDEFDGITEISLSSDAIWVPDLIISEFVDVGKSPV--IPY 131

  Fly   134 ATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDL---KHLDQIPGSNL 195
            ..:..:|:|....|....|:|.:.:..||:|:|.|.:.|.||.::.::|||   :..::|..   
Zfish   132 VYVNCSGKVKNYKPIQVVSACHLEIYAFPFDKQNCTLTFRSWLHSVSEVDLALWRPAEEIAN--- 193

  Fly   196 VQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLE--PFSDITFKLTMRRKTLFYTVNLIVPCVA 258
                 |..||....||::|.||:    .|:...||  .::.|.|.:.:||:.|.|.|.|::|.:.
Zfish   194 -----DTREFMNDGEWELLGVPS----RYWTLNLEDRDYAQIQFNVLIRRRPLLYVVGLLIPSIF 249

  Fly   259 LTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSV 323
            |..:.|:.||||.:||.::|...|||:..||..:.|.:.||.|::..||:|.:....|.|:.||:
Zfish   250 LMVVDVISFYLPPNSGTRITFKTSILLGYTVIRVNLMDEIPATAIKTPLIGVFFAICMALLLLSL 314

  Fly   324 WTTVCVLN-IHFRSPSTHNMS 343
            ..::.|:. :|:.......||
Zfish   315 AMSIFVVKLLHYSEKEVKEMS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRbeta2NP_524483.1 LIC 9..479 CDD:273305 108/346 (31%)
LGIC_ECD_nAChR_proto_alpha-like 29..247 CDD:349832 67/229 (29%)
htr3bXP_021324909.1 Neur_chan_LBD 26..>325 CDD:332142 98/312 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.