DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRbeta2 and Htr3b

DIOPT Version :9

Sequence 1:NP_524483.1 Gene:nAChRbeta2 / 42920 FlyBaseID:FBgn0004118 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_064670.1 Gene:Htr3b / 57014 MGIID:1861899 Length:437 Species:Mus musculus


Alignment Length:350 Identity:92/350 - (26%)
Similarity:167/350 - (47%) Gaps:25/350 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WSLLCVFLLVPLANSTAPISFEANPDTKRLYDDLLSNYNRLIRPVVNNTETLTVWLGLKLSQLIE 68
            ||.|.|.::..|..:|..   ..|....||...||..|::.:|||.|..|..||:|.|.:..:::
Mouse     5 WSCLLVAVVGILGTATPQ---PGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLD 66

  Fly    69 VNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTK 133
            |:::||.:.|::|.::.|.|..|.|:...:..::::.:|...:|.|||::      |..|.:...
Mouse    67 VDVQNQKLKTSVWYREVWNDEFLSWNSSLFDEIQEISLPLSALWAPDIII------NEFVDVERS 125

  Fly   134 ATLKY-----TGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGS 193
            ..|.|     :|.:....|....|:|.:....||:|.|.|.:.|.|..:....:||..|     .
Mouse   126 PDLPYVYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDIDLGFL-----R 185

  Fly   194 NLVQVGIDLTEFYLSVEWDILEVPATKNEEYY--PDTLEPFSDITFKLTMRRKTLFYTVNLIVPC 256
            |...:..|...|....||.:|.|.:|    |:  ..:...|:.|.|.:.:||..|.|.|:|::|.
Mouse   186 NREDIENDKRAFMNDSEWQLLSVSST----YHIRQSSAGDFAQIRFNVVIRRCPLAYVVSLLIPS 246

  Fly   257 VALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSL 321
            :.|..:.:..||||.:...::....::||..|||.:.:::.:|.::...||:|.:....|.|:.|
Mouse   247 IFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTPLIGVFFTVCMALLVL 311

  Fly   322 SVWTTVCVLNIHFRSPSTHNMSPLV 346
            |:..::.::...:....:....||:
Mouse   312 SLSKSILLIKFLYEERHSGQERPLM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRbeta2NP_524483.1 LIC 9..479 CDD:273305 89/344 (26%)
LGIC_ECD_nAChR_proto_alpha-like 29..247 CDD:349832 60/224 (27%)
Htr3bNP_064670.1 LIC 30..431 CDD:273305 85/321 (26%)
Neur_chan_LBD 30..233 CDD:280998 58/217 (27%)
Neur_chan_memb 242..>313 CDD:280999 19/70 (27%)
HA-stretch 377..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.