DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRbeta2 and HTR3C

DIOPT Version :9

Sequence 1:NP_524483.1 Gene:nAChRbeta2 / 42920 FlyBaseID:FBgn0004118 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_570126.2 Gene:HTR3C / 170572 HGNCID:24003 Length:447 Species:Homo sapiens


Alignment Length:343 Identity:88/343 - (25%)
Similarity:162/343 - (47%) Gaps:42/343 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PISFEANPDTKRLYDDLLSNYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQR 85
            |..|:|..|.|            ..||..|.:....|.:...||.::.|:.:.|::|:.||:...
Human    42 PAVFQAVFDRK------------AFRPFTNYSIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLV 94

  Fly    86 WFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIY 150
            |.:..:.|:|:|..|:.:|.|.:|::|:|||.:..:.|.:...:.:| |.:...|.:.::.|...
Human    95 WDNPFINWNPKECVGINKLTVLAENLWLPDIFIVESMDVDQTPSGLT-AYISSEGRIKYDKPMRV 158

  Fly   151 KSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGSNLVQVGID-----LTEFYLSV- 209
            .|.|.:::.|||:|:|.|...|.|:.|.   ||           .:.:|:|     :|:....| 
Human   159 TSICNLDIFYFPFDQQNCTFTFSSFLYT---VD-----------SMLLGMDKEVWEITDTSRKVI 209

  Fly   210 ----EWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLP 270
                ||::|.:.....:....:.|  :..|.|.:.:||:...|.:||:||...|..:..|.||||
Human   210 QTQGEWELLGINKATPKMSMGNNL--YDQIMFYVAIRRRPSLYIINLLVPSSFLVAIDALSFYLP 272

  Fly   271 SDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLN-IHF 334
            ::|..:....|::|:...||.|::.:::|.:  ..||:..|....:.|:.:|:..||.:.. :|.
Human   273 AESENRAPFKITLLLGYNVFLLMMNDLLPAS--GTPLISVYFALCLSLMVVSLLETVFITYLLHV 335

  Fly   335 RSPSTHNMSPLVRKLFLH 352
            .:.....|...:..|.||
Human   336 ATTQPPPMPRWLHSLLLH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRbeta2NP_524483.1 LIC 9..479 CDD:273305 88/343 (26%)
LGIC_ECD_nAChR_proto_alpha-like 29..247 CDD:349832 55/227 (24%)
HTR3CNP_570126.2 Neur_chan_LBD 43..445 CDD:332142 87/342 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.