DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and pHCl-2

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster


Alignment Length:352 Identity:77/352 - (21%)
Similarity:145/352 - (41%) Gaps:59/352 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YNRLIRPVSNNTDTVLVKLGLRLSQLI----DLNLKDQILTTNVWLEHEWQDHKFKWDPSEY--- 113
            |:|::.||.:|.|...|.:.:.....|    :|:..|...|....|:..:.|.:..:  |.|   
  Fly    85 YDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAF--SSYLPN 147

  Fly   114 -----GGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTK---AILHYTGKVVWTPPAIFKSSCE 170
                 .|.:||   .:.:|:|.|.| .|.....|:.|..|   ..::..|.|:.:........|.
  Fly   148 RRQPIMGESEL---KKMLWVPHIFL-TNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCW 208

  Fly   171 IDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAE 235
            ::.:.||||:|.|.....||.|:...:.|..     :.||.|.....|:    ..|::::|....
  Fly   209 MNFQKFPFDEQKCKTTLESWMYNTTLVQLHW-----ETDNPVSFDKQLQ----LTEYNLIGSLYN 264

  Fly   236 R-----HEKY--YPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPAD-SGEK 292
            .     :|.|  :......|..|.|.:.|.|:..:|.::..:|.:.|..:|.:.|:|.|| :..:
  Fly   265 ESIRVSNESYMSHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPAR 329

  Fly   293 IAL-CISIL------LSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHY 350
            ..| |.::|      |||....:.:|.:..|...       :|:.|:.:.|  .::....:|..:
  Fly   330 TTLGCTTLLSFITLSLSQENNLMKVSYVTMSEVW-------FLVCTIFIFG--SLVEFAFVNTIW 385

  Fly   351 RKPSTHKMRP-----WIRSFFIKRLPK 372
            |:.:..:::.     .::|.|:..|.|
  Fly   386 RRNNDLQLKKRTTKYIVKSTFVPHLKK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 52/228 (23%)
LIC 47..544 CDD:273305 77/352 (22%)
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 77/352 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.