DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and GluClalpha

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:374 Identity:80/374 - (21%)
Similarity:149/374 - (39%) Gaps:85/374 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLVLLLLCETVQAN-------PDAKRLYDDLL--SNYNRLIRPVS-NNTD---TVLVKLGLR-LS 79
            :|....||....||       ...|::.|.:|  ..|:..|||.. |.||   .|.|.:.:| :|
  Fly    10 ILYFASLCSASLANNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSIS 74

  Fly    80 QLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSE----YGGVTELYVPSEHIWLPDIVLYNNADGE 140
            ::.|:.::..:..|   ...:|.|.:.|:|..:    |..:||    :..:|:||:...|..:|.
  Fly    75 KIDDVTMEYSVQLT---FREQWTDERLKFDDIQGRLKYLTLTE----ANRVWMPDLFFSNEKEGH 132

  Fly   141 YVVTTMTKAILHY--TGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGS--WTYDGDQIDLKH 201
            :....|....:..  .|.|:::.......:|.::::.:|.|:|.|.::..|  ||.:    ||..
  Fly   133 FHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTN----DLVF 193

  Fly   202 ISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKY-------------YPCCAEPYPDIFF 253
            :.::.|....|:               .|.:|....||:             |.|..   .|:.|
  Fly   194 LWKEGDPVQVVK---------------NLHLPRFTLEKFLTDYCNSKTNTGEYSCLK---VDLLF 240

  Fly   254 NITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSG---EKIALCISILLSQTMFFLLISEIIP 315
                :|:..:|.:.:.|||..:..:|.:.|:|  |.|   .:::|.::.||:.......|:..:|
  Fly   241 ----KREFSYYLIQIYIPCCMLVIVSWVSFWL--DQGAVPARVSLGVTTLLTMATQTSGINASLP 299

  Fly   316 STSLALPL---LGKYLLFTMLLVGLSVVITIIILNIHYR----KPSTHK 357
            ..|....:   .|..|.|.     ...::...::|...|    |.:.||
  Fly   300 PVSYTKAIDVWTGVCLTFV-----FGALLEFALVNYASRSGSNKANMHK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 52/246 (21%)
LIC 47..544 CDD:273305 74/349 (21%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 80/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.