DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and HisCl1

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_731632.1 Gene:HisCl1 / 41426 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster


Alignment Length:333 Identity:66/333 - (19%)
Similarity:122/333 - (36%) Gaps:97/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CLLLVLLLL---------CETVQA---NPDAKRL---YDDLLSNYNRLIRPVSNNT--------- 67
            ||:.:.:.|         |..|..   |.::..|   |:..||..:  |.|:.:.|         
  Fly    13 CLIALAIYLHALEQSIQHCHCVHGYRNNTESAELVSHYESSLSLPD--ILPIPSKTYDKNRAPKL 75

  Fly    68 --DTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFK--------------------WDP 110
              ...:|...:.:..|..:|.:.....|:::|...|:|.:.:                    |.|
  Fly    76 LGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILDVDWLHSIWRP 140

  Fly   111 SEY----GGVT--ELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSC 169
            ..:    ..||  |:.:|:.::|     ||::           |.:| |..|:.      ...||
  Fly   141 DCFFKNAKKVTFHEMSIPNHYLW-----LYHD-----------KTLL-YMSKLT------LVLSC 182

  Fly   170 EIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDK---DNKVEI-GIDLREYYPSVEWDIL 230
            .:....:|.|.|.|.|...|.::..:  ||..|....|.   :.::|: .:|:...|.:      
  Fly   183 AMKFESYPHDTQICSMMIESLSHTVE--DLVFIWNMTDPLVVNTEIELPQLDISNNYTT------ 239

  Fly   231 GVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYL-PADSGEKIA 294
            ....|.....:.|.|     |.||  |||:..::..:..||...|..:|.:.|:: |.....::.
  Fly   240 DCTIEYSTGNFTCLA-----IVFN--LRRRLGYHLFHTYIPSALIVVMSWISFWIKPEAIPARVT 297

  Fly   295 LCISILLS 302
            |.::.||:
  Fly   298 LGVTSLLT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 51/262 (19%)
LIC 47..544 CDD:273305 60/301 (20%)
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 43/232 (19%)
Neur_chan_memb 270..>350 CDD:280999 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.