DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha2 and ZACN

DIOPT Version :9

Sequence 1:NP_524482.1 Gene:nAChRalpha2 / 42919 FlyBaseID:FBgn0000039 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_851321.2 Gene:ZACN / 353174 HGNCID:29504 Length:412 Species:Homo sapiens


Alignment Length:303 Identity:64/303 - (21%)
Similarity:130/303 - (42%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEY--GGVTELYVPSEHI 126
            :|.:..:||.:.:.:|.:.::::....:::.:.|...|.|.:..|:.|.:  ..:|   :|.|.:
Human    54 NNGSAPLLVDVRVFVSNVFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAIT---LPWESL 115

  Fly   127 WLPDIVLYNNADGEYVVTTMTKAI------------LHYTGKVVWTPPAIFKSSCEIDVRYFPFD 179
            |.|.:             |:.:|:            :...|.|........:::|..::.:||.|
Human   116 WTPRL-------------TILEALWVDWRDQSPQARVDQDGHVKLNLALATETNCNFELLHFPRD 167

  Fly   180 QQTCFMKFGSWTYDGDQIDLK-HISQKNDKDNKVEIGIDLREYYPSVEWDI-LGVPAERHEKYYP 242
            ...|.:.|.:.:....:::.: |:..        ||....|||   |.:|: ..||.   ::..|
Human   168 HSNCSLSFYALSNTAMELEFQAHVVN--------EIVSVKREY---VVYDLKTQVPP---QQLVP 218

  Fly   243 CCAEPYPDIFFNITLRRK--TLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTM 305
            |         |.:|||.|  .|...:.|::|...:....|....||..:.|:|...:::|||..:
Human   219 C---------FQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLV 274

  Fly   306 FFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNI 348
            ....:.:.:||:|...|||..|....:||:.||.:.|:::..:
Human   275 LHSSLVQALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nAChRalpha2NP_524482.1 LGIC_ECD_nAChR_proto_alpha-like 44..263 CDD:349832 41/216 (19%)
LIC 47..544 CDD:273305 64/303 (21%)
ZACNNP_851321.2 LIC 11..368 CDD:273305 64/303 (21%)
Neur_chan_LBD 54..>187 CDD:280998 24/148 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.